This is a working overview of lipolysis, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2026-08-01 and is reviewed periodically as new material appears.
Interest in AOD-9604 arose from attempts to separate metabolic effects from growth effects attributed to hGH. Early work explored whether the fragment could influence lipolysis or fat oxidation without promoting growth. Those questions remain partly unresolved because human data are limited and results have varied across studies. The peptide is not a hormone replacement for hGH and is not equivalent to hGH in clinical use. Its research history includes both laboratory studies and commercial marketing claims that are not the same as regulatory approval.
AOD-9604 is a synthetic peptide whose structure corresponds to a C-terminal segment of human growth hormone. It is often described as hGH fragment 176-191, a 16-amino-acid sequence. The peptide was designed to isolate a region of hGH associated with fat metabolism while avoiding the full hormone's growth-promoting actions. Laboratory and commercial materials typically present it as a lyophilized powder for research use. Its identity is defined by amino acid sequence, not by a single brand.
In the scientific literature, AOD-9604 appears in reviews of growth hormone fragments and in discussions of peptide-based metabolic research. Some sources distinguish it from growth hormone itself, while others group it with compounds marketed for weight management. The evidence base is small compared with approved obesity medications. Questions about long-term efficacy and clinical relevance remain open, and independent replication of key findings is limited. Most published reports are early-stage and exploratory.
AOD-9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It is often described as hGH fragment 176-191. Research interest arose because it was designed to isolate possible effects on fat metabolism from other actions of growth hormone. It is not a full growth hormone molecule. Its development history includes early laboratory and animal studies followed by human trials. The peptide has been examined in laboratory, animal, and limited human studies.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Synthetic peptide | Based on the C-terminal region of human growth hormone. |
| Amino acid length | 16 residues | Often described as hGH fragment 176-191. |
| Appearance | Lyophilized powder | Typically white to off-white; exact appearance depends on grade. |
| Solubility | Soluble in water | Aqueous solubility depends on pH, ionic strength, and preparation. |
| Typical storage | -20 °C or lower | Lyophilized peptide is usually kept cold and dry; solutions may require freezing. |
Detection of AOD-9604 in biological samples relies on analytical techniques capable of distinguishing a small synthetic peptide from related endogenous sequences. Liquid chromatography coupled with tandem mass spectrometry is commonly used for confirmatory analysis. Sample preparation may involve immunoaffinity enrichment or solid-phase extraction to concentrate the peptide. Because the molecule is small and may be present at low concentrations, assay sensitivity and specificity are ongoing analytical challenges. Laboratories also validate methods against reference materials when available.
Regulatory interest in AOD-9604 increased after high-profile anti-doping cases involving peptide products. In some cases, the substance was supplied under alternative names or in compounded preparations, complicating traceability. Sports tribunals and anti-doping panels have discussed whether the peptide was explicitly banned at the time of use, leading to clarifications by the World Anti-Doping Agency. For consumers and researchers, the legal status can vary by jurisdiction, and products marketed as research chemicals may lack independent quality verification.
AOD-9604 is listed as a prohibited substance in sport by the World Anti-Doping Agency. It falls under the peptide hormones, growth factors, related substances, and mimetics class on the prohibited list. Anti-doping organizations treat its presence in an athlete's sample as an adverse finding unless a therapeutic use exemption applies. The prohibition reflects concerns about performance enhancement in competitive settings and the difficulty of distinguishing exogenous peptide use from endogenous hormone fragments.
Clinical development of AOD9604 included trials in people with obesity, but the results did not lead to approval as a prescription medicine in major markets. Interest later shifted to research settings and to unapproved products marketed for body composition. Regulatory agencies have questioned whether the peptide qualifies as a dietary ingredient, and some have issued warnings about its presence in supplements. Long-term human safety data are limited, and questions about efficacy, dosing, and target populations remain unresolved.
AOD9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It corresponds to a short sequence near the end of the 191-amino-acid hormone, often described as residues 176–191 or a related fragment. Researchers designed it to separate metabolic effects from the growth-promoting actions of full-length growth hormone. Early work in the 1990s explored it as a candidate for weight and lipid disorders. It is not a naturally circulating hormone fragment produced in large amounts.
Clinical development of AOD-9604 included trials in people with obesity. Reports from early-phase and mid-phase studies described modest or inconsistent changes in body weight. A phase IIb program did not meet its primary endpoint, and the compound was not approved for medical use. Differences in formulation, delivery route, and participant characteristics may explain some of the variation. Later investigations explored whether the peptide might have effects in other tissues, including cartilage.
Regulatory treatment of AOD-9604 is shaped by its classification as a peptide hormone. The World Anti-Doping Agency lists it as a prohibited substance, and many national anti-doping organizations adopt that list. It does not hold approval as a prescription medicine in the United States, the European Union, or other major markets. Products sold online are frequently labeled for research use only and may not undergo independent quality testing. Import and possession rules differ by country, so legal status depends on local law.
Regulatory status varies by country. In the United States, AOD-9604 is not approved as a prescription drug. It is sometimes sold as a research chemical or dietary supplement, though such marketing may fall outside legal frameworks. The World Anti-Doping Agency prohibits its use in sport. Researchers must obtain it through legitimate suppliers and follow institutional rules. Its legal classification continues to evolve as authorities increasingly assess peptide products more broadly.
AOD-9604 is a synthetic peptide whose sequence matches the C-terminal fragment of human growth hormone, specifically residues 176 through 191. This region differs from the full hormone in its receptor interactions. The peptide is not a growth hormone secretagogue and does not bind the growth hormone receptor in the same manner. Researchers have examined it for effects on lipid metabolism, but its exact pharmacological profile remains an active area of study.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
After replication of the desired region, the RNA primer is removed by DNA polymerase I via the process of nick translation. The removal of the RNA primer allows DNA ligase to ligate the DNA-DNA nick between the new fragment and the previous strand. DNA polymerase I & III, along with many other enzymes are all required for the high fidelity, high-processivity of DNA replication. Beta clamp DNA polymerase DNA replication Overview at Oregon State University DNA+Polymerase+III at the U.S. National Library of Medicine Medical Subject Headings (MeSH) Clamping down on pathogenic bacteria[link removed] – how to shut down a key DNA polymerase complex
The iron-containing co-factor is found tightly associated with the protein. It can be released upon denaturation with 2-mercaptoethanol or guanidine hydrochloride. Expression of the Hmd gene in E. coli without the co-factor results in an inactive holoenzyme. However, hydrogenase activity can be rescued by the addition of the iron-containing cofactor taken from denatured active enzyme. As mentioned, irradiation of the cofactor with UV light results in the loss of CO and Fe. In addition the 542 Da compound can be further degraded by a phosphodiesterase (which specifically cleaves phosphate bonds). Hydrolysis of the phosphate bonds generates the ribonucleotide guanosine monophosphate and a modified 2-pyridone. On the basis of spectroscopic characterization, Shima et al. have proposed a structure for this organic cofactor (minus the iron atom and CO molecules) as shown:
In its oxidized form, azurin (Cu2+Az) receives an electron from its redox partner and is reduced according to the following reaction: Cu2+Az + e− → Cu+Az The redox potential is 310 mV. The highly interconnected beta-sheet structure of azurin is strongly coupled with its electron-transfer center (the copper-binding side). Considerable experimental evidence exists to suggest that hydrogen bonds play a role in the long-distance electron transfer mechanism of azurin. Taken together, these observations suggest that electrons tunnel through the protein along its polypeptide and hydrogen bonds, making azurin a useful model system for studying long-range, intraprotein electron transfer (LRET).
Different 2A peptides have different peptide-bond-skipping efficiencies, with T2A and P2A being the most efficient and F2A the least efficient. Therefore, up to 50% of F2A-linked proteins can in fact be produced as a fusion protein, which might cause some unpredictable outcomes, including a gain of function. One study reported that 2A sites cause the ribosome to fall off approximately 60% of the time, and that, together with ribosome read-through of about 10% for P2A and T2A, this results in reducing expression of the downstream peptide chain by about 70%. However, the level of drop-off detected in this study varied widely depending on the exact construct used, with some constructs showing little evidence of drop-off; furthermore, within a tri-cistronic transcript it reported a higher level of ribosome drop-off after one 2A sequence than after two 2As combined, which is at odds with a linear model of translation. IRES Recombinant DNA
Sources: en.wikipedia.org
Ca2+ currents through cardiomyocyte gap junctions mediate synchronized contraction of cardiac tissue. As a result, GCaMP expression in cardiomyocytes, both in vitro and in vivo, has been used to study Ca2+-influx-dependent excitation and contraction in zebrafish and mice. For instance, Tallini et al. (2006) expressed GCaMP2 in mouse embryos to show that, at embryonic day 10.5, electrical conduction was rapid in the atria and ventricles but slow in the atrioventricular canal. Chi et al. (2008) used a transgenic cardiac-specific GCaMP zebrafish line to image cardiomyocyte activation throughout the cardiac cycle; from their results, they characterized four developmental stages of the zebrafish cardiac conduction system and identified 17 novel mutations affecting cardiac conduction. However, uncontrolled expression of GCaMP leads to cardiac hypertrophy due to overexpression of the calmodulin motif, which interferes with intracellular calcium signaling. As a result, experiments using cardiac tissue should carefully control the level of GCaMP expression.
In biochemistry, two biopolymers are antiparallel if they run parallel to each other but with opposite directionality (alignments). An example is the two complementary strands of a DNA double helix, which run in opposite directions alongside each other. Nucleic acid molecules have a phosphoryl (5') end and a hydroxyl (3') end. This notation follows from organic chemistry nomenclature, and can be used to define the movement of enzymes such as DNA polymerases relative to the DNA strand in a non-arbitrary manner.
The centrifugal partition chromatograph instrument is constituted with a unique rotor which contains the column. This rotor rotates on its central axis (while HSCCC column rotates on its planetary axis and simultaneously rotates eccentrically about another solar axis). With less vibrations and noise, the CPC offers a typical rotation speed range from 500 to 2000 rpm. Contrary to hydrodynamic CCC, the rotation speed is not directly proportional to the retention volume ratio of the stationary phase. Like DCCC, CPC can be operated in either descending or ascending mode, where the direction is relative to the force generated by the rotor rather than gravity. A redesigned CPC column with larger chambers and channels has been named centrifugal partition extraction (CPE). In the CPE design, faster flow rates and increased column loading can be achieved.
A disintegrin and metalloproteinase with thrombospondin motifs 7 (ADAMTS7) is an enzyme that in humans is encoded by the ADAMTS7 gene on chromosome 15. It is ubiquitously expressed in many tissues and cell types. This enzyme was historically reported to catalyze the degradation of cartilage oligomeric matrix protein (COMP), though subsequent studies using purified proteins and unbiased mass spectrometry found that ADAMTS7 does not cleave COMP. ADAMTS7 has been associated with cancer and arthritis in multiple tissue types. The ADAMTS7 gene is a well-established genetic susceptibility locus for coronary artery disease. The ADAMTS7 gene resides on chromosome 15 at the band 15q24.2 and contains 25 exons.
Sources: en.wikipedia.org
Fast parallel proteolysis (FASTpp) is a method to determine the thermostability of proteins by measuring which fraction of protein resists rapid proteolytic digestion. Proteolysis is widely used in biochemistry and cell biology to probe protein structure. In "limited trypsin proteolysis", low amounts of protease digest both folded and unfolded protein but at largely different rates: unstructured proteins are cut more rapidly, while structured proteins are cut at a slower rate (sometimes by orders of magnitude). Recently, several other assays of protein stability based on proteolysis have been proposed, exploiting other proteases with high specificity for cleaving unfolded proteins. These include Pulse Proteolysis, Proteolytic Scanning Calorimetry and FASTpp.
Biomaterials are used in: Joint replacements Bone plates Intraocular lenses (IOLs) for eye surgery Bone cement Artificial ligaments and tendons Dental implants for tooth fixation Blood vessel prostheses Heart valves Skin repair devices (artificial tissue) Cochlear replacements Contact lenses Breast implants Drug delivery mechanisms Sustainable materials Vascular grafts Stents Nerve conduits Surgical sutures, clips, and staples for wound closure Pins and screws for fracture stabilisation Surgical mesh Biomaterials must be compatible with the body, and there are often issues of biocompatibility, which must be resolved before a product can be placed on the market and used in a clinical setting. Because of this, biomaterials are usually subjected to the same requirements as those undergone by new drug therapies. All manufacturing companies are also required to ensure traceability of all of their products, so that if a defective product is discovered, others in the same batch may be traced.
CRISPR gene editing is a revolutionary technology that allows for precise, targeted modifications to the DNA of living organisms. Developed from a natural defense mechanism found in bacteria, CRISPR-Cas9 is the most commonly used system. Gene editing with CRISPR-Cas9 involves a Cas9 nuclease and an engineered guide RNA, which come together to allow for the precise "cutting" of one or both strands of DNA at specific locations within the genome. It makes use of the cell's natural DNA repair systems, including non-homologous end joining, homology-directed repair, or mismatch repair, to modify, insert, or delete genetic material at these specific cut sites. This technology has transformed fields such as genetics, medicine, and agriculture, offering potential treatments for genetic disorders, advancements in crop engineering, and research into the fundamental workings of life. However, its ethical implications and potential unintended consequences have sparked significant debate.
A throat culture may be done to investigate the cause of a sore throat. Most sore throats are caused by viral infections. However, in some cases the cause of a sore throat may be unclear and a throat culture can be used to determine if the infection is bacterial. Identifying the responsible organism can guide treatment. The person receiving the throat culture is asked to tilt his or her head back and open his or her mouth. The health professional will press the tongue down with a tongue depressor and examine the mouth and throat. A clean swab will be rubbed over the back of the throat, around the tonsils, and over any red areas or sores to collect a sample. The sample may also be collected using a throat washout. For this test, the patient will gargle a small amount of salt water and then spit the fluid into a clean cup. This method gives a larger sample than a throat swab and may make the culture more reliable. A culture for Streptococcus pyogenes can take 18–24 hours when grown at 37 degrees Celsius (body temperature).
The most widely used method to determine absolute molar mass is size-exclusion chromatography (SEC) coupled with multi-angle laser light scattering (MALS). SEC can separate macromolecules based on their size by passing an analyte containing molecules of different sizes through a column containing porous substrate. Larger components of the analyte spend less time traveling through these pores and therefore elute faster, while smaller components can access more of these pores and are therefore retained longer. However, molar masses determined through SEC require calibration curves constructed from standards, and calculating absolute molar masses require absolute detection systems. The two primary detection systems used to determine absolute molar mass are light scattering photometers and viscometers. Static light scattering (SLS) experiments measure the difference between the light scattered by a dilute solution and the light scattered through pure solvent. Given a dilute enough solution and at an angle of θ = 0° between the incident light and the scattering direction, this difference, known as the excess Rayleigh ratio ΔR(θ), can be approximately related to the weight-average molar mass Mw through the equation:
Sources: en.wikipedia.org
It is a synthetic peptide based on a C-terminal fragment of human growth hormone. It is commonly referred to as hGH fragment 176-191 and is studied for metabolic effects rather than growth effects.
No. It represents only a short portion of the hGH sequence and lacks the full hormone's structure. As a result, its biological activity and regulatory status differ from those of prescription hGH.
The exact peptide is not typically described as a circulating hormone; it is a synthetic construct based on a natural sequence. Fragments of hGH can exist in laboratory or metabolic contexts, but AOD-9604 itself is manufactured for research.
It is a synthetic peptide fragment derived from the C-terminal region of human growth hormone, commonly referred to as hGH fragment 176-191. It has been investigated for effects on fat metabolism, but it is not an approved medication in most jurisdictions.