If you have been reading about lipolysis and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-03-03. Where a claim depends on a specific study, the study is described rather than over-claimed.
AOD9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It corresponds to a short sequence near the end of the 191-amino-acid hormone, often described as residues 176–191 or a related fragment. Researchers designed it to separate metabolic effects from the growth-promoting actions of full-length growth hormone. Early work in the 1990s explored it as a candidate for weight and lipid disorders. It is not a naturally circulating hormone fragment produced in large amounts.
Laboratory studies have reported that AOD9604 can increase lipolysis and reduce lipid accumulation in fat cells. The precise molecular target remains uncertain, and the compound does not appear to activate the growth hormone receptor in the same way as full-length hGH. Proposed mechanisms include effects on beta-adrenergic signaling and enzymes involved in fatty acid synthesis, but these pathways are not firmly established. Because most evidence comes from cell and animal models, whether the same effects occur in humans is an open question.
Clinical development of AOD9604 included trials in people with obesity, but the results did not lead to approval as a prescription medicine in major markets. Interest later shifted to research settings and to unapproved products marketed for body composition. Regulatory agencies have questioned whether the peptide qualifies as a dietary ingredient, and some have issued warnings about its presence in supplements. Long-term human safety data are limited, and questions about efficacy, dosing, and target populations remain unresolved.
AOD-9604 is a synthetic peptide that corresponds to a short section of human growth hormone. It is commonly identified as hGH fragment 176-191 because its sequence matches residues at the C-terminal end of the hormone. The molecule contains sixteen amino acids and is made by solid-phase peptide synthesis. Researchers study it for metabolic effects rather than for the growth-promoting actions associated with full human growth hormone. Its small size distinguishes it from the complete 191-amino-acid hormone.
Several names appear in scientific and commercial settings. AOD9604 and AOD-9604 are development codes used interchangeably, while hGH fragment 176-191 describes the same region. The peptide includes a disulfide bond between two cysteine residues, which helps shape its three-dimensional structure. Different suppliers may provide acetate or other salt forms, and purity can vary. These differences matter because analytical tests and biological assays can respond to the specific form being studied.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Synthetic peptide | Derived from C-terminal region of human growth hormone |
| Approximate molecular mass | About 1.8 kDa | Varies with sequence length and counterions |
| Confirmed receptor target | None established | No confirmed growth hormone receptor agonism |
| Reported in vitro activity | Lipolysis stimulation and lipogenesis inhibition | Observed mainly in adipocyte models; human relevance uncertain |
| Regulatory status | Not approved as a drug in major markets | May be treated differently across jurisdictions; not a recognized dietary ingredient in some countries |
The citric acid cycle is regulated mainly by the availability of key substrates, particularly the ratio of NAD+ to NADH and the concentrations of calcium, inorganic phosphate, ATP, ADP, and AMP. Citrate – the ion that gives its name to the cycle – is a feedback inhibitor of citrate synthase and also inhibits PFK, providing a direct link between the regulation of the citric acid cycle and glycolysis.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Immunofluorescence imaging in the human U2OS cell line (bone Osteosarcoma epithelial cells) shows localization in the cytosol. Immunohistochemistry imaging of human prostate tissue also suggests cytosolic localization. A bipartite nuclear localization signal is predicted at position 128 – 143, which is highly conserved in mammalian orthologs (see Fig.2.), indicating possible localization in the nucleus. The predicted promoter sequence for this gene spans from base pair 37196852 to 37198126 (1,275 bp) and has multiple predicted binding sites for transcription factors such as GATA binding factors, SMAD3, TP63 and NRF1. MIPOL1 is ubiquitously expressed at low levels in humans, with highest expression in the prostate. The RNA secondary structure is stabilized by multiple stem loops that have been predicted (using bioinformatics tools), and conserved across closely related species. Multiple binding targets are found for microRNAs such as MIR3163 and MIR190a, that could silence these regions on the mRNA and inhibit translation.
Sources: en.wikipedia.org
Chinese hamster ovary (CHO) cells are a family of immortalized cell lines derived from epithelial cells of the ovary of the Chinese hamster, often used in biological and medical research and commercially in the production of recombinant therapeutic proteins. They have found wide use in studies of genetics, toxicity screening, nutrition and gene expression, and particularly since the 1980s to express recombinant proteins. CHO cells are the most commonly used mammalian hosts for industrial production of recombinant protein therapeutics.
14-3-3 proteins are a family of conserved regulatory molecules that are expressed in all eukaryotic cells. 14-3-3 proteins have the ability to bind a multitude of functionally diverse signaling proteins, including kinases, phosphatases, and transmembrane receptors. More than 200 signaling proteins have been reported as 14-3-3 ligands. Elevated amounts of 14-3-3 protein in cerebrospinal fluid are usually a sign of rapid neurodegeneration; a common indicator of Creutzfeldt–Jakob disease.
Benazepril (Lotensin) Cilazapril (Inhibace) Enalapril (Vasotec/Renitec/Berlipril/Enap/Enalapril Profarma) Imidapril (Tanatril) Lisinopril (Listril/Lopril/Novatec/Prinivil/Zestril, Lisidigal) Moexipril (Univasc) Perindopril (Coversyl/Aceon/Perindo) Quinapril (Accupril) Ramipril (Altace/Prilace/Ramace/Ramiwin/Triatec/Tritace/Ramitac) Trandolapril (Mavik/Odrik/Gopten) Ceronapril (never marketed) Fosinopril (Fositen/Monopril) ACE inhibitor peptides can be derived from natural sources such as algae, fruit, seeds, dairy and animal products. A comprehensive resource on anti-hypertensive peptides is available in the form of a database. It contains around 1700 unique antihypertensive peptides. Arfalasin (HOE 409) is an angiotensin antagonist.
MT-ND6 is a gene of the mitochondrial genome coding for the NADH-ubiquinone oxidoreductase chain 6 protein (ND6). The ND6 protein is a subunit of NADH dehydrogenase (ubiquinone), which is located in the mitochondrial inner membrane and is the largest of the five complexes of the electron transport chain. Variations in the human MT-ND6 gene are associated with Leigh's syndrome, Leber's hereditary optic neuropathy (LHON) and dystonia.
Sources: en.wikipedia.org
AAA proteases use the energy from ATP hydrolysis to translocate a protein inside the proteasome for degradation. Cdc48p/p97 functions as a hexameric AAA+ ATPase that provides the mechanical force necessary for substrate dislocation. Its activity is tightly regulated by ATP binding and hydrolysis, which induce conformational changes required for protein unfolding and extraction. The HbYX motif plays a crucial role in regulating this process by mediating interactions between Cdc48p/p97 and downstream effectors such as the 20S proteasome or specific cofactors (e.g., Ufd1/Npl4). This interaction facilitates substrate transfer from Cdc48p/p97 to the proteasome, ensuring efficient protein degradation. Given its pivotal role in protein homeostasis, Cdc48p/p97 has been implicated in a wide range of cellular processes beyond ERAD, including autophagy, mitochondrial quality control, and DNA repair. The dysregulation of its function, particularly through mutations affecting the ATPase domain or HbYX-mediated interactions, has been linked to neurodegenerative diseases and cancer.
In 2004, development of an antisense therapy for spinal muscular atrophy began. Over the following years, an antisense oligonucleotide later named nusinersen was developed by Ionis Pharmaceuticals under a licensing agreement with Biogen. In December 2016, nusinersen received regulatory approval from FDA and soon after, from other regulatory agencies worldwide. As of 2020, more than 50 antisense oligonucleotides were in clinical trials, including over 25 in advanced clinical trials (phase II or III). A follow-on drug to Inotersen is being developed by Ionis Pharmaceuticals and under license to Akcea Therapeutics for hereditary transthyretin-mediated amyloidosis. In this formulation the ASO is conjugated to N-Acetylgalactosamine enabling hepatocyte-specific delivery, greatly reducing dose requirements and side effect profile while increasing the level of transthyretin reduction in patients.
25499Es + 4820Ca → 302119Uue* → no atoms It is highly unlikely that this reaction will be able to create any atoms of ununennium in the near future, given the extremely difficult task of making sufficient amounts of einsteinium-254, which is favoured for production of ultraheavy elements because of its large mass, relatively long half-life of 270 days, and availability in significant amounts of several micrograms, to make a large enough target to increase the sensitivity of the experiment to the required level; einsteinium has not been found in nature and has only been produced in laboratories, and in quantities smaller than those needed for effective synthesis of superheavy elements. However, given that ununennium is only the first period 8 element on the extended periodic table, it may well be discovered in the near future through other reactions, and indeed an attempt to synthesise it is currently ongoing in Japan. Currently, none of the period 8 elements has been discovered yet, and it is also possible, due to drip instabilities, that only the lower period 8 elements, up to around element 128, are physically possible. No attempts at synthesis have been made for any heavier alkali metals: due to their extremely high atomic number, they would require new, more powerful methods and technology to make.
Sources: en.wikipedia.org
AOD9604 is a synthetic peptide based on a C-terminal segment of human growth hormone. It is manufactured by chemical peptide synthesis rather than extracted from human tissue. The sequence is often described as hGH fragment 176–191 or a close variant.
It is not approved as a prescription drug in the United States or the European Union for any indication. Regulatory status can differ by country, and it is often sold as a research chemical or in unapproved products. Such products are not equivalent to an approved medicine.
In the studies reported so far, AOD9604 does not appear to act through the growth hormone receptor and has not shown the typical IGF-1 increase caused by full-length hGH. Human data are limited, so this remains an area of uncertainty. It should not be assumed to have the same effects as hGH.
AOD-9604 is a synthetic peptide fragment of human growth hormone. It corresponds to the C-terminal region known as hGH 176-191 and is studied for metabolic effects. It is not an approved therapeutic drug.